Crystal structure of iron-regulated surface determinant protein a from staphylococcus aureus- targeted domain 47...188
PDB DOI: 10.2210/pdb2o1a/pdb
Classification: SURFACE ACTIVE PROTEIN Organism(s): Staphylococcus Aureus
Deposited: 2006-11-28 Deposition Author(s): Chang, C. , Gu, M. , Joachimiak, A. , Midwest Center For Structural Genomics (Mcsg) , Mulligan, R.
Crystal structure of iron-regulated surface determinant protein a from staphylococcus aureus- targeted domain 47...188
Chang, C. , Gu, M. , Joachimiak, A. , Midwest Center For Structural Genomics (Mcsg) , Mulligan, R.
Primary Citation of Related Structures: 2O1A
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Iron-regulated surface determinant protein A | A | 142 | Staphylococcus Aureus | ATEATNATNNQSTQVSQATSQPINFQVQKDGSSEKSHMDDYMQHPGKVIKQNNKYYFQTVLNNASFWKEYKFYNANNQELATTVVNDNKKADTRTINVAVEPGYKSLTTKVHIVVPQINYNHRYTTHLEFEKAIPTLADAAK |
Method: X-RAY DIFFRACTION
Deposited Date: 2006-11-28 Deposition Author(s): Chang, C. , Gu, M. , Joachimiak, A. , Midwest Center For Structural Genomics (Mcsg) , Mulligan, R.