X-ray crystal structure of protein cc0527 (v27m / l66m double mutant) from caulobacter crescentus. northeast structural genomics consortium target ccr55.
PDB DOI: 10.2210/pdb2o0p/pdb
Classification: STRUCTURAL GENOMICS, UNKNOWN FUNCTION Organism(s): Thermomonospora Curvata (Strain Atcc 19995 / Dsm 43183 / Jcm 3096 / Nbrc 15933 / Ncimb 10081 / Henssen B9)
Deposited: 2006-11-27 Deposition Author(s): Acton, T.B. , Baran, M.C. , Cunningham, K. , Fang, Y. , Hunt, J.F. , Liu, J. , Ma, L. , Montelione, G.T. , Northeast Structural Genomics Consortium (Nesg) , Rost, B. , Seetharaman, J. , Su, M. , Tong, L. , Wang, D. , Xiao, R.
Method: X-RAY DIFFRACTION Resolution: 1.9 Å
X-ray crystal structure of protein cc0527 (v27m / l66m double mutant) from caulobacter crescentus. northeast structural genomics consortium target ccr55.
Acton, T.B. , Baran, M.C. , Cunningham, K. , Fang, Y. , Hunt, J.F. , Liu, J. , Ma, L. , Montelione, G.T. , Northeast Structural Genomics Consortium (Nesg) , Rost, B. , Seetharaman, J. , Su, M. , Tong, L. , Wang, D. , Xiao, R.
Primary Citation of Related Structures: 2O0P
Proteins | ||||
---|---|---|---|---|
Molecule | Chains | Sequence Length | Organism | Sequence |
Hypothetical protein CC0527 | A | 122 | Thermomonospora Curvata (Strain Atcc 19995 / Dsm 43183 / Jcm 3096 / Nbrc 15933 / Ncimb 10081 / Henssen B9) | MTLIYKILSRAEWDAAKAQGRFEGSAMDLADGFIHLSAGEQAQETAAKWFRGQANLVLLAVEAEPMGEDLKWEASRGGARFPHLYRPLLVSEVTREADLDLDADGVPQLGDHLALEHHHHHH |
Method: X-RAY DIFFRACTION
Deposited Date: 2006-11-27 Deposition Author(s): Acton, T.B. , Baran, M.C. , Cunningham, K. , Fang, Y. , Hunt, J.F. , Liu, J. , Ma, L. , Montelione, G.T. , Northeast Structural Genomics Consortium (Nesg) , Rost, B. , Seetharaman, J. , Su, M. , Tong, L. , Wang, D. , Xiao, R.