Nmr structure analysis of the penetratin conjugated gas (374-394) peptide
PDB DOI: 10.2210/pdb2nzz/pdb
Classification: MEMBRANE PROTEIN Organism(s): N.A.
Deposited: 2006-11-27 Deposition Author(s): Albrizio, S. , D'Errico, G. , D'Ursi, A.M. , Espsito, C. , Novellino, E. , Rovero, P.
Method: SOLUTION NMR Resolution: N.A.
Nmr structure analysis of the penetratin conjugated gas (374-394) peptide
Albrizio, S. , D'Errico, G. , D'Ursi, A.M. , Espsito, C. , Novellino, E. , Rovero, P.
Primary Citation of Related Structures: 2NZZ
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Penetratin conjugated Gas (374-394) peptide | A | 37 | N.A. | RQIKIWFQNRRMKWKKRVFNDARDIIQRMHLRQYELL |
Method: SOLUTION NMR
Deposited Date: 2006-11-27 Deposition Author(s): Albrizio, S. , D'Errico, G. , D'Ursi, A.M. , Espsito, C. , Novellino, E. , Rovero, P.