Crystal structure of a complex of griffithsin cocrystallized with n-acetylglucosamine
PDB DOI: 10.2210/pdb2nu5/pdb
Classification: ANTIVIRAL PROTEIN,SUGAR BINDING PROTEIN Organism(s): Griffithsia Sp.
Deposited: 2006-11-08 Deposition Author(s): Wlodawer, A. , Ziolkowska, N.E.
Crystal structure of a complex of griffithsin cocrystallized with n-acetylglucosamine
Wlodawer, A. , Ziolkowska, N.E.
Primary Citation of Related Structures: 2NU5
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| griffithsin | A | 122 | Griffithsia Sp. | XSLTHRKFGGSGGSPFSGLSSIAVRSGSYLDAIIIDGVHHGGSGGNLSPTFTFGSGEYISNMTIRSGDYIDNISFETNMGRRFGPYGGSGGSANTLSNVKVIQINGSAGDYLDSLDIYYEQY |
| griffithsin | B | 122 | Griffithsia Sp. | XSLTHRKFGGSGGSPFSGLSSIAVRSGSYLDAIIIDGVHHGGSGGNLSPTFTFGSGEYISNMTIRSGDYIDNISFETNMGRRFGPYGGSGGSANTLSNVKVIQINGSAGDYLDSLDIYYEQY |
Method: X-RAY DIFFRACTION
Deposited Date: 2006-11-08 Deposition Author(s): Wlodawer, A. , Ziolkowska, N.E.