Molecular structures of the complexes of sgpb with omtky3 aromatic p1 variants trp18i, his18i, phe18i and tyr18i
PDB DOI: 10.2210/pdb2nu1/pdb
Classification: HYDROLASE Organism(s): Meleagris Gallopavo , Streptomyces Griseus
Deposited: 2006-11-08 Deposition Author(s): Anderson, S. , Bateman, K.S. , Huang, K. , James, M.N.G. , Laskowski Jr., M. , Lu, W. , Qasim, M.A.
Molecular structures of the complexes of sgpb with omtky3 aromatic p1 variants trp18i, his18i, phe18i and tyr18i
Anderson, S. , Bateman, K.S. , Huang, K. , James, M.N.G. , Laskowski Jr., M. , Lu, W. , Qasim, M.A.
Primary Citation of Related Structures: 2NU1
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Streptogrisin B | E | 185 | Meleagris Gallopavo , Streptomyces Griseus | ISGGDAIYSSTGRCSLGFNVRSGSTYYFLTAGHCTDGATTWWANSARTTVLGTTSGSSFPNNDYGIVRYTNTTIPKDGTVGGQDITSAANATVGMAVTRRGSTTGTHSGSVTALNATVNYGGGDVVYGMIRTNVCAEPGDSGGPLYSGTRAIGLTSGGSGNCSSGGTTFFQPVTEALSAYGVSVY |
| Ovomucoid | I | 51 | Meleagris Gallopavo , Streptomyces Griseus | VDCSEYPKPACTHEYRPLCGSDNKTYGNKCNFCNAVVESNGTLTLSHFGKC |
Method: X-RAY DIFFRACTION
Deposited Date: 2006-11-08 Deposition Author(s): Anderson, S. , Bateman, K.S. , Huang, K. , James, M.N.G. , Laskowski Jr., M. , Lu, W. , Qasim, M.A.