The solution structure of the rapamycin-binding domain of mtor (frb)
PDB DOI: 10.2210/pdb2npu/pdb
Classification: TRANSFERASE Organism(s): Homo Sapiens
Deposited: 2006-10-30 Deposition Author(s): Bird, I. , Carr, M.D. , Crabbe, T. , Lennie, G. , Muskett, F.W. , Taylor, R.J. , Veverka, V.
The solution structure of the rapamycin-binding domain of mtor (frb)
Bird, I. , Carr, M.D. , Crabbe, T. , Lennie, G. , Muskett, F.W. , Taylor, R.J. , Veverka, V.
Primary Citation of Related Structures: 2NPU
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| FKBP12-rapamycin complex-associated protein | A | 126 | Homo Sapiens | MSYYHHHHHHDYDIPTTENLYFQGAMELIRVPILWHEMWHEGLEEASRLYFGERNVKGMFEVLEPLHAMMERGPQTLKETSFNQAYGRDLMEAQEWCRKYMKSGNVKDLTQAWDLYYHVFRRISKQ |
Method: SOLUTION NMR
Deposited Date: 2006-10-30 Deposition Author(s): Bird, I. , Carr, M.D. , Crabbe, T. , Lennie, G. , Muskett, F.W. , Taylor, R.J. , Veverka, V.