General structural motifs of amyloid protofilaments
PDB DOI: 10.2210/pdb2nnt/pdb
Classification: PROTEIN FIBRIL Organism(s): Salmonella Enterica
Deposited: 2006-10-24 Deposition Author(s): Becker, J. , Berriman, J. , Ferguson, N. , Fersht, A.R. , Flinders, J. , Krause, G. , Oschkinat, H. , Petrovich, M. , Sharpe, T.D. , Tidow, H. , Tremmel, S.
General structural motifs of amyloid protofilaments
Becker, J. , Berriman, J. , Ferguson, N. , Fersht, A.R. , Flinders, J. , Krause, G. , Oschkinat, H. , Petrovich, M. , Sharpe, T.D. , Tidow, H. , Tremmel, S.
Primary Citation of Related Structures: 2NNT
Proteins | ||||
---|---|---|---|---|
Molecule | Chains | Sequence Length | Organism | Sequence |
Transcription elongation regulator 1 | A | 40 | Salmonella Enterica | GSMGATAVSEWTEYKTADGKTFYYNNRTLESTWEKPQELK |
Transcription elongation regulator 1 | B | 40 | Salmonella Enterica | GSMGATAVSEWTEYKTADGKTFYYNNRTLESTWEKPQELK |
Transcription elongation regulator 1 | C | 40 | Salmonella Enterica | GSMGATAVSEWTEYKTADGKTFYYNNRTLESTWEKPQELK |
Transcription elongation regulator 1 | D | 40 | Salmonella Enterica | GSMGATAVSEWTEYKTADGKTFYYNNRTLESTWEKPQELK |
Method: SOLID-STATE NMR
Deposited Date: 2006-10-24 Deposition Author(s): Becker, J. , Berriman, J. , Ferguson, N. , Fersht, A.R. , Flinders, J. , Krause, G. , Oschkinat, H. , Petrovich, M. , Sharpe, T.D. , Tidow, H. , Tremmel, S.