Crystal structure of bacillus subtilis yqgq, pfam duf910
PDB DOI: 10.2210/pdb2nn4/pdb
Classification: STRUCTURAL GENOMICS, UNKNOWN FUNCTION Organism(s): Bacillus Subtilis
Deposited: 2006-10-23 Deposition Author(s): Burley, S.K. , Damodharan, L. , Eswaramoorthy, S. , New York Sgx Research Center For Structural Genomics (Nysgxrc) , Swaminathan, S.
Crystal structure of bacillus subtilis yqgq, pfam duf910
Burley, S.K. , Damodharan, L. , Eswaramoorthy, S. , New York Sgx Research Center For Structural Genomics (Nysgxrc) , Swaminathan, S.
Primary Citation of Related Structures: 2NN4
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Hypothetical protein yqgQ | A | 72 | Bacillus Subtilis | SLNTFYDVQQLLKTFGHIVYFGDRELEIEFMLDELKELYMNHMIEKEQWARAAAVLRKELEQTKNGRDFYKG |
| Hypothetical protein yqgQ | B | 72 | Bacillus Subtilis | SLNTFYDVQQLLKTFGHIVYFGDRELEIEFMLDELKELYMNHMIEKEQWARAAAVLRKELEQTKNGRDFYKG |
| Hypothetical protein yqgQ | C | 72 | Bacillus Subtilis | SLNTFYDVQQLLKTFGHIVYFGDRELEIEFMLDELKELYMNHMIEKEQWARAAAVLRKELEQTKNGRDFYKG |
Method: X-RAY DIFFRACTION
Deposited Date: 2006-10-23 Deposition Author(s): Burley, S.K. , Damodharan, L. , Eswaramoorthy, S. , New York Sgx Research Center For Structural Genomics (Nysgxrc) , Swaminathan, S.