Nmr assignment and structure of a peptide derived from the membrane proximal external region of hiv-1 gp41 in the presence of dodecylphosphocholine micelles
PDB DOI: 10.2210/pdb2ncs/pdb
Classification: VIRAL PROTEIN Organism(s): N.A.
Deposited: 2016-04-14 Deposition Author(s): Bruix, M. , Jimenez, M. , Nieva, J.L. , Partida-Hanon, A. , Rujas, E.
Nmr assignment and structure of a peptide derived from the membrane proximal external region of hiv-1 gp41 in the presence of dodecylphosphocholine micelles
Bruix, M. , Jimenez, M. , Nieva, J.L. , Partida-Hanon, A. , Rujas, E.
Primary Citation of Related Structures: 2NCS
Proteins | ||||
---|---|---|---|---|
Molecule | Chains | Sequence Length | Organism | Sequence |
Envelope glycoprotein gp41 | A | 36 | N.A. | KKKKDKWASLWNWFDITNWLWYIKLFIMIVGKKKKK |
Method: SOLUTION NMR
Deposited Date: 2016-04-14 Deposition Author(s): Bruix, M. , Jimenez, M. , Nieva, J.L. , Partida-Hanon, A. , Rujas, E.