Nmr solution structure for the c-terminal domain of tetrahymena tcb2 in the presence of calcium
PDB DOI: 10.2210/pdb2ncp/pdb
Classification: METAL BINDING PROTEIN Organism(s): Tetrahymena Thermophila
Deposited: 2016-04-11 Deposition Author(s): Fowler, A. , Kilpatrick, A.M.
Nmr solution structure for the c-terminal domain of tetrahymena tcb2 in the presence of calcium
Primary Citation of Related Structures: 2NCP
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| 25 kDa calcium-binding protein | A | 102 | Tetrahymena Thermophila | SSKPKYNPEVEAKLDVARRLFKRYDKDGSGQLQDDEIAGLLKDTYAEMGMSNFTPTKEDVKIWLQMADTNSDGSVSLEEYEDLIIKSLQKAGIRVEKQSLVF |
Method: SOLUTION NMR
Deposited Date: 2016-04-11 Deposition Author(s): Fowler, A. , Kilpatrick, A.M.