Solution nmr structure of palmitated scp2l2 from aedes aegypti
PDB DOI: 10.2210/pdb2nbn/pdb
Classification: LIPID TRANSPORT Organism(s): Aedes Aegypti
Deposited: 2016-03-07 Deposition Author(s): Singarapu, K.K. , Ummanni, R.
Method: SOLUTION NMR Resolution: N.A.
Solution nmr structure of palmitated scp2l2 from aedes aegypti
Primary Citation of Related Structures: 2NBN
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Sterol carrier protein 2-like 2 | A | 111 | Aedes Aegypti | MSVETIIERIKARVGAVDPNGPRKVLGVFQLNIKTASGVEQWIVDLKQLKVDQGVFASPDVTVTVGLEDMLAISGKTLTVGDALKQGKIELSGDADLAAKLAEVIHHHHHH |
Method: SOLUTION NMR
Deposited Date: 2016-03-07 Deposition Author(s): Singarapu, K.K. , Ummanni, R.