1h, 13c, and 15n chemical shift assignments for in-cell gb1
PDB DOI: 10.2210/pdb2n9l/pdb
Classification: IMMUNE SYSTEM Organism(s): Streptococcus Sp. 'Group G'
Deposited: 2015-11-30 Deposition Author(s): Guentert, P. , Hanashima, T. , Hosoya, S. , Ikeda, S. , Ikeya, T. , Ito, Y. , Mishima, M. , Shimazaki, M.
Method: SOLUTION NMR Resolution: N.A.
1h, 13c, and 15n chemical shift assignments for in-cell gb1
Guentert, P. , Hanashima, T. , Hosoya, S. , Ikeda, S. , Ikeya, T. , Ito, Y. , Mishima, M. , Shimazaki, M.
Primary Citation of Related Structures: 2N9L
Proteins | ||||
---|---|---|---|---|
Molecule | Chains | Sequence Length | Organism | Sequence |
Immunoglobulin G-binding protein G | A | 57 | Streptococcus Sp. 'Group G' | MGTYKLILNGKTLKGETTTEAVDAATAEKVFKQYANDNGVDGEWTYDDATKTFTVTE |
Method: SOLUTION NMR
Deposited Date: 2015-11-30 Deposition Author(s): Guentert, P. , Hanashima, T. , Hosoya, S. , Ikeda, S. , Ikeya, T. , Ito, Y. , Mishima, M. , Shimazaki, M.