Nmr structure of yeast bcd1 protein zinc finger
PDB DOI: 10.2210/pdb2n94/pdb
Classification: METAL BINDING PROTEIN Organism(s): Saccharomyces Cerevisiae
Deposited: 2015-11-05 Deposition Author(s): Bragantini, B. , Manival, X. , Quinternet, M.
Nmr structure of yeast bcd1 protein zinc finger
Bragantini, B. , Manival, X. , Quinternet, M.
Primary Citation of Related Structures: 2N94
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Box C/D snoRNA protein 1 | A | 48 | Saccharomyces Cerevisiae | GPHMAVLCGVCGIKEFKYKCPRCLVQTCSLECSKKHKTRDNCSGQTHD |
Method: SOLUTION NMR
Deposited Date: 2015-11-05 Deposition Author(s): Bragantini, B. , Manival, X. , Quinternet, M.