Solution structure of the rnedd4 ww1 domain by nmr
PDB DOI: 10.2210/pdb2n8s/pdb
Classification: LIGASE Organism(s): Rattus Norvegicus
Deposited: 2015-10-27 Deposition Author(s): Kieken, F. , Sorgen, P.L. , Spagnol, G.
Method: SOLUTION NMR Resolution: N.A.
Solution structure of the rnedd4 ww1 domain by nmr
Kieken, F. , Sorgen, P.L. , Spagnol, G.
Primary Citation of Related Structures: 2N8S
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| E3 ubiquitin-protein ligase NEDD4 | A | 39 | Rattus Norvegicus | GSPSPLPPGWEERQDVLGRTYYVNHESRTTQWKRPSPED |
Method: SOLUTION NMR
Deposited Date: 2015-10-27 Deposition Author(s): Kieken, F. , Sorgen, P.L. , Spagnol, G.