Nmr structure of the prolactin receptor transmembrane domain
PDB DOI: 10.2210/pdb2n7i/pdb
Classification: HORMONE RECEPTOR Organism(s): Homo Sapiens
Deposited: 2015-09-11 Deposition Author(s): Bugge, K. , Kragelund, B.B.
Nmr structure of the prolactin receptor transmembrane domain
Primary Citation of Related Structures: 2N7I
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Prolactin receptor | A | 37 | Homo Sapiens | GSFTMNDTTVWISVAVLSAVICLIIVWAVALKGYSMV |
Method: SOLUTION NMR
Deposited Date: 2015-09-11 Deposition Author(s): Bugge, K. , Kragelund, B.B.