Two-fold symmetric structure of the 18-60 construct of s31n m2 from influenza a in lipid bilayers
PDB DOI: 10.2210/pdb2n70/pdb
Classification: VIRAL PROTEIN Organism(s): Streptomyces Hygroscopicus Subsp. Limoneus
Deposited: 2015-09-01 Deposition Author(s): Andreas, L.B. , Chou, J.J. , Eddy, M.T. , Emsley, L. , Gelev, V. , Griffin, R.G. , Miller, E.A. , Ni, Q. , Pintacuda, G. , Reese, M.
Two-fold symmetric structure of the 18-60 construct of s31n m2 from influenza a in lipid bilayers
Andreas, L.B. , Chou, J.J. , Eddy, M.T. , Emsley, L. , Gelev, V. , Griffin, R.G. , Miller, E.A. , Ni, Q. , Pintacuda, G. , Reese, M.
Primary Citation of Related Structures: 2N70
Proteins | ||||
---|---|---|---|---|
Molecule | Chains | Sequence Length | Organism | Sequence |
Matrix protein 2 | A | 43 | Streptomyces Hygroscopicus Subsp. Limoneus | RSNDSSDPLVVAANIIGILHLILWILDRLFFKSIYRFFEHGLK |
Matrix protein 2 | B | 43 | Streptomyces Hygroscopicus Subsp. Limoneus | RSNDSSDPLVVAANIIGILHLILWILDRLFFKSIYRFFEHGLK |
Matrix protein 2 | C | 43 | Streptomyces Hygroscopicus Subsp. Limoneus | RSNDSSDPLVVAANIIGILHLILWILDRLFFKSIYRFFEHGLK |
Matrix protein 2 | D | 43 | Streptomyces Hygroscopicus Subsp. Limoneus | RSNDSSDPLVVAANIIGILHLILWILDRLFFKSIYRFFEHGLK |
Method: SOLID-STATE NMR
Deposited Date: 2015-09-01 Deposition Author(s): Andreas, L.B. , Chou, J.J. , Eddy, M.T. , Emsley, L. , Gelev, V. , Griffin, R.G. , Miller, E.A. , Ni, Q. , Pintacuda, G. , Reese, M.