2N66
Nmr structure of sweeter mutant (d40k) of sweet protein brazzein,
PDB DOI: 10.2210/pdb2n66/pdb
Classification: PLANT PROTEIN Organism(s): Pentadiplandra Brazzeana
Deposited: 2015-08-13 Deposition Author(s): Assadi-Porter, F. , Markley, J.L. , Singarapu, K.K. , Tonelli, M.
Experimental Data Snapshot
Method: SOLUTION NMR Resolution: N.A.
Nmr structure of sweeter mutant (d40k) of sweet protein brazzein,
Assadi-Porter, F. , Markley, J.L. , Singarapu, K.K. , Tonelli, M.
Primary Citation of Related Structures: 2N66
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Defensin-like protein | A | 54 | Pentadiplandra Brazzeana | QDKCKKVYENYPVSKCQLANQCNYDCKLDKHARSGECFYKEKRNLQCICDYCEY |
Experimental Data
Method: SOLUTION NMR
Deposited Date: 2015-08-13 Deposition Author(s): Assadi-Porter, F. , Markley, J.L. , Singarapu, K.K. , Tonelli, M.