Spatial structure of egfr transmembrane and juxtamembrane domains in dpc micelles
PDB DOI: 10.2210/pdb2n5s/pdb
Classification: TRANSFERASE Organism(s): Salmonella Enterica
Deposited: 2015-07-27 Deposition Author(s): Arseniev, A. , Bocharov, E. , Bocharova, O. , Mineev, K.
Spatial structure of egfr transmembrane and juxtamembrane domains in dpc micelles
Arseniev, A. , Bocharov, E. , Bocharova, O. , Mineev, K.
Primary Citation of Related Structures: 2N5S
Proteins | ||||
---|---|---|---|---|
Molecule | Chains | Sequence Length | Organism | Sequence |
Epidermal growth factor receptor | A | 54 | Salmonella Enterica | GSCKIPSIATGMVGALLLLLVVALGIGLFMRRRHIVRKRTLRRLLQERELVEGG |
Method: SOLUTION NMR
Deposited Date: 2015-07-27 Deposition Author(s): Arseniev, A. , Bocharov, E. , Bocharova, O. , Mineev, K.