2N58
Structure of an n-terminal membrane-anchoring region of the glycosyltransferase waag
PDB DOI: 10.2210/pdb2n58/pdb
Classification: TRANSFERASE Organism(s): N.A.
Deposited: 2015-07-13 Deposition Author(s): Liebau, J. , Maler, L. , Pettersson, P. , Szpryngiel, S.
Experimental Data Snapshot
Method: SOLUTION NMR Resolution: N.A.
Structure of an n-terminal membrane-anchoring region of the glycosyltransferase waag
Liebau, J. , Maler, L. , Pettersson, P. , Szpryngiel, S.
Primary Citation of Related Structures: 2N58
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Lipopolysaccharide core biosynthesis protein RfaG | A | 30 | N.A. | YAEKVAQEKGFLYRLTSRYRHYAAFERATF |
Experimental Data
Method: SOLUTION NMR
Deposited Date: 2015-07-13 Deposition Author(s): Liebau, J. , Maler, L. , Pettersson, P. , Szpryngiel, S.