Ec-nmr structure of synechocystis sp. pcc 6803 slr1183 determined by combining evolutionary couplings (ec) and sparse nmr data. northeast structural genomics consortium target sgr145
PDB DOI: 10.2210/pdb2n47/pdb
Classification: STRUCTURAL GENOMICS, UNKNOWN FUNCTION Organism(s): Synechocystis Sp. Pcc 6803 Substr. Kazusa
Deposited: 2015-06-17 Deposition Author(s): Hopf, T.A. , Huang, Y.J. , Marks, D. , Montelione, G.T. , Northeast Structural Genomics Consortium (Nesg) , Sander, C. , Tang, Y.
Ec-nmr structure of synechocystis sp. pcc 6803 slr1183 determined by combining evolutionary couplings (ec) and sparse nmr data. northeast structural genomics consortium target sgr145
Hopf, T.A. , Huang, Y.J. , Marks, D. , Montelione, G.T. , Northeast Structural Genomics Consortium (Nesg) , Sander, C. , Tang, Y.
Primary Citation of Related Structures: 2N47
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Slr1183 protein | A | 202 | Synechocystis Sp. Pcc 6803 Substr. Kazusa | MWDERFSQSEYVYGTEPNDFLVSVANQIPQGKILCLAEGEGRNACFLASLGYEVTAVDQSSVGLAKAKQLAQEKGVKITTVQSNLADFDIVADAWEGIVSIFCHLPSSLRQQLYPKVYQGLKPGGVFILEGFAPEQLQYNTGGPKDLDLLPKLETLQSELPSLNWLIANNLERNLDEGAYHQGKAALIQLLGQKLEHHHHHH |
Method: SOLUTION NMR
Deposited Date: 2015-06-17 Deposition Author(s): Hopf, T.A. , Huang, Y.J. , Marks, D. , Montelione, G.T. , Northeast Structural Genomics Consortium (Nesg) , Sander, C. , Tang, Y.