Nmr structure of the complex between the ph domain of the tfb1 subunit from tfiih and the n-terminal activation domain of eklf (tad1)
PDB DOI: 10.2210/pdb2n23/pdb
Classification: TRANSCRIPTION Organism(s): Homo Sapiens , Saccharomyces Cerevisiae S288C
Deposited: 2015-04-27 Deposition Author(s): Arseneault, G. , Lecoq, L. , Morse, T. , Omichinski, J. , Raiola, L.
Nmr structure of the complex between the ph domain of the tfb1 subunit from tfiih and the n-terminal activation domain of eklf (tad1)
Arseneault, G. , Lecoq, L. , Morse, T. , Omichinski, J. , Raiola, L.
Primary Citation of Related Structures: 2N23
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| RNA polymerase II transcription factor B subunit 1 | A | 115 | Homo Sapiens , Saccharomyces Cerevisiae S288C | PSHSGAAIFEKVSGIIAINEDVSPAELTWRSTDGDKVHTVVLSTIDKLQATPASSEKMMLRLIGKVDESKKRKDNEGNEVVPKPQRHMFSFNNRTVMDNIKMTLQQIISRYKDAD |
| Krueppel-like factor 1 | B | 19 | Homo Sapiens , Saccharomyces Cerevisiae S288C | DTQDDFLKWWRSEEAQDMG |
Method: SOLUTION NMR
Deposited Date: 2015-04-27 Deposition Author(s): Arseneault, G. , Lecoq, L. , Morse, T. , Omichinski, J. , Raiola, L.