2N1O
Pin1 ww domain in complex with a phosphorylated cpeb1 derived peptide
PDB DOI: 10.2210/pdb2n1o/pdb
Classification: Isomerase/Translation regulator Organism(s): Homo Sapiens , Synthetic Construct
Deposited: 2015-04-13 Deposition Author(s): Macias, M. , Martin-Malpartida, P. , Schelhorn, C.
Experimental Data Snapshot
Method: SOLUTION NMR Resolution: N.A.
Pin1 ww domain in complex with a phosphorylated cpeb1 derived peptide
Macias, M. , Martin-Malpartida, P. , Schelhorn, C.
Primary Citation of Related Structures: 2N1O
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Peptidyl-prolyl cis-trans isomerase NIMA-interacting 1 | A | 33 | Homo Sapiens , Synthetic Construct | LPPGWEKRMSRSSGRVYYFNHITNASQWERPSG |
| Cytoplasmic polyadenylation element-binding protein 1 | B | 8 | Homo Sapiens , Synthetic Construct | RISPPLPF |
Experimental Data
Method: SOLUTION NMR
Deposited Date: 2015-04-13 Deposition Author(s): Macias, M. , Martin-Malpartida, P. , Schelhorn, C.