Solution structure of vstx1
PDB DOI: 10.2210/pdb2n1n/pdb
Classification: TOXIN Organism(s): Grammostola Rosea
Deposited: 2015-04-12 Deposition Author(s): King, G.F. , Lau, H.Y. , Mobli, M.
Method: SOLUTION NMR Resolution: N.A.
Solution structure of vstx1
King, G.F. , Lau, H.Y. , Mobli, M.
Primary Citation of Related Structures: 2N1N
Proteins | ||||
---|---|---|---|---|
Molecule | Chains | Sequence Length | Organism | Sequence |
Kappa-theraphotoxin-Gr3a | A | 35 | Grammostola Rosea | SECGKFMWKCKNSNDCCKDLVCSSRWKWCVLASPF |
Method: SOLUTION NMR
Deposited Date: 2015-04-12 Deposition Author(s): King, G.F. , Lau, H.Y. , Mobli, M.