Solution nmr structure of pdfl2.1 from arabidopsis thaliana
PDB DOI: 10.2210/pdb2mz0/pdb
Classification: ANTIMICROBIAL PROTEIN Organism(s): Arabidopsis Thaliana
Deposited: 2015-02-05 Deposition Author(s): Bohlmann, H. , Omidvar, R. , Veglia, G. , Xia, Y.
Solution nmr structure of pdfl2.1 from arabidopsis thaliana
Bohlmann, H. , Omidvar, R. , Veglia, G. , Xia, Y.
Primary Citation of Related Structures: 2MZ0
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Defensin-like protein 32 | A | 55 | Arabidopsis Thaliana | KDIDGRKPLLIGTCIEFPTEKCNKTCIESNFAGGKCVHIGQSLDFVCVCFPKYYI |
Method: SOLUTION NMR
Deposited Date: 2015-02-05 Deposition Author(s): Bohlmann, H. , Omidvar, R. , Veglia, G. , Xia, Y.