Nmr structure of an odin-sam1 fragment
PDB DOI: 10.2210/pdb2myq/pdb
Classification: SIGNALING PROTEIN Organism(s): N.A.
Deposited: 2015-01-30 Deposition Author(s): Leone, M. , Mercurio, F.A.
Nmr structure of an odin-sam1 fragment
Primary Citation of Related Structures: 2MYQ
Proteins | ||||
---|---|---|---|---|
Molecule | Chains | Sequence Length | Organism | Sequence |
Ankyrin repeat and SAM domain-containing protein 1A | A | 45 | N.A. | XSKLLLNGFDDVHFLGSNVMEEQDLRDIGISDPQHRRKLLQAARX |
Method: SOLUTION NMR
Deposited Date: 2015-01-30 Deposition Author(s): Leone, M. , Mercurio, F.A.