Nmr structure of spider toxin- g7w/n24s mutant of trtx-hhn2b
PDB DOI: 10.2210/pdb2mxo/pdb
Classification: TOXIN Organism(s): Haplopelma Hainanum
Deposited: 2015-01-08 Deposition Author(s): Chin, Y.K.Y. , Klint, J.K. , Mobli, M.
Nmr structure of spider toxin- g7w/n24s mutant of trtx-hhn2b
Chin, Y.K.Y. , Klint, J.K. , Mobli, M.
Primary Citation of Related Structures: 2MXO
Proteins | ||||
---|---|---|---|---|
Molecule | Chains | Sequence Length | Organism | Sequence |
Mu-theraphotoxin-Hhn2b | A | 34 | Haplopelma Hainanum | AECKGFWKSCVPGKNECCSGYACSSRDKWCKVLL |
Method: SOLUTION NMR
Deposited Date: 2015-01-08 Deposition Author(s): Chin, Y.K.Y. , Klint, J.K. , Mobli, M.