Nmr structure of phosphorylated 4e-bp2
PDB DOI: 10.2210/pdb2mx4/pdb
Classification: Translation,protein Binding Organism(s): Homo Sapiens
Deposited: 2014-12-10 Deposition Author(s): Bah, A. , Forman-Kay, J. , Kay, L. , Krzeminski, M. , Muhandiram, R. , Siddiqui, Z. , Sonenberg, N. , Vernon, R. , Zhao, C.
Nmr structure of phosphorylated 4e-bp2
Bah, A. , Forman-Kay, J. , Kay, L. , Krzeminski, M. , Muhandiram, R. , Siddiqui, Z. , Sonenberg, N. , Vernon, R. , Zhao, C.
Primary Citation of Related Structures: 2MX4
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Eukaryotic translation initiation factor 4E-binding protein 2 | A | 45 | Homo Sapiens | PTRTVAISDAAQLPHDYCTTPGGTLFSTTPGGTRIIYDRKFLLDR |
Method: SOLUTION NMR
Deposited Date: 2014-12-10 Deposition Author(s): Bah, A. , Forman-Kay, J. , Kay, L. , Krzeminski, M. , Muhandiram, R. , Siddiqui, Z. , Sonenberg, N. , Vernon, R. , Zhao, C.