Mdmx-p53
PDB DOI: 10.2210/pdb2mwy/pdb
Classification: Cell Cycle/Antitumor Protein Organism(s): Homo Sapiens , Synthetic Construct
Deposited: 2014-12-03 Deposition Author(s): Grace, C.R.
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Protein Mdm4 | A | 89 | Homo Sapiens , Synthetic Construct | QINQVRPKLPLLKILHAAGAQGEMFTVKEVMHYLGQYIMVKQLYDQQEQHMVYCGGDLLGELLGRQSFSVKDPSPLYDMLRKNLVTLAT |
| Cellular tumor antigen p53 | B | 15 | Homo Sapiens , Synthetic Construct | SQETFSDLWKLLPEN |
Method: SOLUTION NMR
Deposited Date: 2014-12-03 Deposition Author(s): Grace, C.R.