Nmr structure of crotalicidin in dpc micelles
PDB DOI: 10.2210/pdb2mwt/pdb
Classification: antimicrobial, antitumor protein Organism(s): N.A.
Deposited: 2014-11-24 Deposition Author(s): Jimenez, M. , Zamora-Carreras, H.
Method: SOLUTION NMR Resolution: N.A.
Nmr structure of crotalicidin in dpc micelles
Jimenez, M. , Zamora-Carreras, H.
Primary Citation of Related Structures: 2MWT
Proteins | ||||
---|---|---|---|---|
Molecule | Chains | Sequence Length | Organism | Sequence |
Cathelicidin-like peptide | A | 34 | N.A. | KRFKKFFKKVKKSVKKRLKKIFKKPMVIGVTIPF |
Method: SOLUTION NMR
Deposited Date: 2014-11-24 Deposition Author(s): Jimenez, M. , Zamora-Carreras, H.