Structure of the complex of ubiquitin and the ubiquitin-like (ubl) domain of ddi1
PDB DOI: 10.2210/pdb2mws/pdb
Classification: PROTEIN TRANSPORT Organism(s): Homo Sapiens , Saccharomyces Cerevisiae S288C
Deposited: 2014-11-23 Deposition Author(s): Fushman, D. , Nowicka, U. , Walker, O.
Structure of the complex of ubiquitin and the ubiquitin-like (ubl) domain of ddi1
Fushman, D. , Nowicka, U. , Walker, O.
Primary Citation of Related Structures: 2MWS
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Ubiquitin | A | 76 | Homo Sapiens , Saccharomyces Cerevisiae S288C | MQIFVKTLTGKXITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGG |
| DNA damage-inducible protein 1 | B | 94 | Homo Sapiens , Saccharomyces Cerevisiae S288C | MRGSHHHHHHGSDLTISNELTGEIYGPIEVSEDMALTDLIALLQADCGFDKTKHDLYYNMDILDSNRTQSLKELGLKTDDLLLIRGKISNSKLN |
Method: SOLUTION NMR
Deposited Date: 2014-11-23 Deposition Author(s): Fushman, D. , Nowicka, U. , Walker, O.