Solution structure of 53bp1 tandem tudor domains in complex with a p53k370me2 peptide
PDB DOI: 10.2210/pdb2mwo/pdb
Classification: TRANSCRIPTION/ANTITUMOR PROTEIN Organism(s): Salmonella Enterica , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.)
Deposited: 2014-11-15 Deposition Author(s): Botuyan, M.V. , Cui, G. , Mer, G.
Solution structure of 53bp1 tandem tudor domains in complex with a p53k370me2 peptide
Botuyan, M.V. , Cui, G. , Mer, G.
Primary Citation of Related Structures: 2MWO
Proteins | ||||
---|---|---|---|---|
Molecule | Chains | Sequence Length | Organism | Sequence |
Tumor suppressor p53-binding protein 1 | A | 123 | Salmonella Enterica , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) | GHMNSFVGLRVVAKWSSNGYFYSGKITRDVGAGKYKLLFDDGYECDVLGKDILLCDPIPLDTEVTALSEDEYFSAGVVKGHRKESGELYYSIEKEGQRKWYKRMAVILSLEQGNRLREQYGLG |
Cellular tumor antigen p53 | B | 15 | Salmonella Enterica , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) | RAHSSHLKSKKGQST |
Method: SOLUTION NMR
Deposited Date: 2014-11-15 Deposition Author(s): Botuyan, M.V. , Cui, G. , Mer, G.