Nmr structure of fbp28 ww2 mutant y446l
PDB DOI: 10.2210/pdb2mwa/pdb
Classification: TRANSCRIPTION Organism(s): Homo Sapiens
Deposited: 2014-11-03 Deposition Author(s): Macias, M.J. , Scheraga, H. , Sunol, D. , Todorovski, T.
Nmr structure of fbp28 ww2 mutant y446l
Macias, M.J. , Scheraga, H. , Sunol, D. , Todorovski, T.
Primary Citation of Related Structures: 2MWA
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Transcription elongation regulator 1 | A | 37 | Homo Sapiens | GATAVSEWTEYKTADGKTLYYNNRTLESTWEKPQELK |
Method: SOLUTION NMR
Deposited Date: 2014-11-03 Deposition Author(s): Macias, M.J. , Scheraga, H. , Sunol, D. , Todorovski, T.