Tetramerization domain of the ciona intestinalis p53/p73-b transcription factor protein
PDB DOI: 10.2210/pdb2mw4/pdb
Classification: TRANSCRIPTION Organism(s): Ciona Intestinalis
Deposited: 2014-10-27 Deposition Author(s): Doetsch, V. , Heering, J.P. , Jonker, H.R.A. , Loehr, F. , Schwalbe, H.
Tetramerization domain of the ciona intestinalis p53/p73-b transcription factor protein
Doetsch, V. , Heering, J.P. , Jonker, H.R.A. , Loehr, F. , Schwalbe, H.
Primary Citation of Related Structures: 2MW4
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Transcription factor protein | A | 47 | Ciona Intestinalis | SDGDVVYTLNIRGKRKFEKVKEYKEALDLLDYVQPDVKKACCQRNQI |
| Transcription factor protein | B | 47 | Ciona Intestinalis | SDGDVVYTLNIRGKRKFEKVKEYKEALDLLDYVQPDVKKACCQRNQI |
| Transcription factor protein | C | 47 | Ciona Intestinalis | SDGDVVYTLNIRGKRKFEKVKEYKEALDLLDYVQPDVKKACCQRNQI |
| Transcription factor protein | D | 47 | Ciona Intestinalis | SDGDVVYTLNIRGKRKFEKVKEYKEALDLLDYVQPDVKKACCQRNQI |
Method: SOLUTION NMR
Deposited Date: 2014-10-27 Deposition Author(s): Doetsch, V. , Heering, J.P. , Jonker, H.R.A. , Loehr, F. , Schwalbe, H.