The n-domain of the aaa metalloproteinase yme1 from saccharomyces cerevisiae
PDB DOI: 10.2210/pdb2mv3/pdb
Classification: NUCLEOTIDE BINDING PROTEIN Organism(s): Saccharomyces Cerevisiae S288C
Deposited: 2014-09-22 Deposition Author(s): Coles, M. , Lupas, A.N. , Martin, J. , Scharfenberg, F. , Serek-Heuberger, J.
The n-domain of the aaa metalloproteinase yme1 from saccharomyces cerevisiae
Coles, M. , Lupas, A.N. , Martin, J. , Scharfenberg, F. , Serek-Heuberger, J.
Primary Citation of Related Structures: 2MV3
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Mitochondrial inner membrane i-AAA protease supercomplex subunit YME1 | A | 88 | Saccharomyces Cerevisiae S288C | MVAVSHAMLATREQEANKDLTSPDAQAAFYKLLLQSNYPQYVVSRFETPGIASSPECMELYMEALQRIGRHSEADAVRQNLEHHHHHH |
Method: SOLUTION NMR
Deposited Date: 2014-09-22 Deposition Author(s): Coles, M. , Lupas, A.N. , Martin, J. , Scharfenberg, F. , Serek-Heuberger, J.