Solution structure of the human faap20 ubz
PDB DOI: 10.2210/pdb2muq/pdb
Classification: Ubiquitin Binding Protein Organism(s): Homo Sapiens
Deposited: 2014-09-16 Deposition Author(s): Wang, S. , Wojtaszek, J.L. , Zhou, P.
Solution structure of the human faap20 ubz
Wang, S. , Wojtaszek, J.L. , Zhou, P.
Primary Citation of Related Structures: 2MUQ
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Fanconi anemia-associated protein of 20 kDa | A | 44 | Homo Sapiens | SHMGAAALRSCPMCQKEFAPRLTQLDVDSHLAQCLAESTEDVTW |
Method: SOLUTION NMR
Deposited Date: 2014-09-16 Deposition Author(s): Wang, S. , Wojtaszek, J.L. , Zhou, P.