The nmr structure of the rubredoxin domain of the no reductase flavorubredoxin from escherichia coli
PDB DOI: 10.2210/pdb2ms3/pdb
Classification: ELECTRON TRANSPORT Organism(s): Escherichia Coli K-12
Deposited: 2014-07-22 Deposition Author(s): Lamosa, P.M. , Silva, E. , Teixeira, M. , Turner, D.L.
Method: SOLUTION NMR Resolution: N.A.
The nmr structure of the rubredoxin domain of the no reductase flavorubredoxin from escherichia coli
Lamosa, P.M. , Silva, E. , Teixeira, M. , Turner, D.L.
Primary Citation of Related Structures: 2MS3
Proteins | ||||
---|---|---|---|---|
Molecule | Chains | Sequence Length | Organism | Sequence |
Anaerobic nitric oxide reductase flavorubredoxin | A | 57 | Escherichia Coli K-12 | GPRMQCSVCQWIYDPAKGEPMQDVAPGTPWSEVPDNFLCPECSLGKDVFEELASEAK |
Method: SOLUTION NMR
Deposited Date: 2014-07-22 Deposition Author(s): Lamosa, P.M. , Silva, E. , Teixeira, M. , Turner, D.L.