2MRK
Fyn sh2 domain in complex with the natural inhibitory phosphotyrosine peptide
PDB DOI: 10.2210/pdb2mrk/pdb
Classification: TRANSFERASE Organism(s): Salmonella Enterica , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.)
Deposited: 2014-07-09 Deposition Author(s): Buts, L. , Huculeci, R. , Lenaerts, A.J. , Van Nuland, N.
Experimental Data Snapshot
Method: SOLUTION NMR Resolution: N.A.
Fyn sh2 domain in complex with the natural inhibitory phosphotyrosine peptide
Buts, L. , Huculeci, R. , Lenaerts, A.J. , Van Nuland, N.
Primary Citation of Related Structures: 2MRK
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Tyrosine-protein kinase Fyn | A | 100 | Salmonella Enterica , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) | WYFGKLGRKDAERQLLSFGNPRGTFLIRESETTKGAYSLSIRDWDDMKGDHVKHYKIRKLDNGGYYITTRAQFETLQQLVQHYSERAAGLCCRLVVPCHK |
| C-terminal Tyrosine-protein kinase Fyn | B | 10 | Salmonella Enterica , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) | EPQYQPGENL |
Experimental Data
Method: SOLUTION NMR
Deposited Date: 2014-07-09 Deposition Author(s): Buts, L. , Huculeci, R. , Lenaerts, A.J. , Van Nuland, N.