Nmr structure of uba domain of dna-damage-inducible 1 protein (ddi1)
PDB DOI: 10.2210/pdb2mr9/pdb
Classification: HYDROLASE Organism(s): Saccharomyces Cerevisiae
Deposited: 2014-07-02 Deposition Author(s): Fushman, D. , Zhang, D.
Nmr structure of uba domain of dna-damage-inducible 1 protein (ddi1)
Primary Citation of Related Structures: 2MR9
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| DNA damage-inducible protein 1 | A | 44 | Saccharomyces Cerevisiae | GSATFPEQTIKQLMDLGFPRDAVVKALKQTNGNAEFAASLLFQS |
Method: SOLUTION NMR
Deposited Date: 2014-07-02 Deposition Author(s): Fushman, D. , Zhang, D.