Spatial structure of hm-3, a membrane-active spider toxin affecting sodium channels
PDB DOI: 10.2210/pdb2mqu/pdb
Classification: TOXIN Organism(s): Heriaeus Melloteei
Deposited: 2014-06-27 Deposition Author(s): Berkut, A.A. , Grishin, E.V. , Myshkin, M.Y. , Paramonov, A.S. , Shenkarev, Z.O. , Vassilevski, A.A.
Spatial structure of hm-3, a membrane-active spider toxin affecting sodium channels
Berkut, A.A. , Grishin, E.V. , Myshkin, M.Y. , Paramonov, A.S. , Shenkarev, Z.O. , Vassilevski, A.A.
Primary Citation of Related Structures: 2MQU
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Neurotoxin Hm-3 | A | 35 | Heriaeus Melloteei | GCIAKNKECAWFSGEWCCGALSCKYSIKRNLKICV |
Method: SOLUTION NMR
Deposited Date: 2014-06-27 Deposition Author(s): Berkut, A.A. , Grishin, E.V. , Myshkin, M.Y. , Paramonov, A.S. , Shenkarev, Z.O. , Vassilevski, A.A.