Structural investigation of hnrnp l bound to rna
PDB DOI: 10.2210/pdb2mqp/pdb
Classification: RNA BINDING PROTEIN/RNA Organism(s): Pandinus Imperator , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.)
Deposited: 2014-06-24 Deposition Author(s): Allain, F. , Blatter, M.
Method: SOLUTION NMR Resolution: N.A.
Structural investigation of hnrnp l bound to rna
Primary Citation of Related Structures: 2MQP
Proteins | ||||
---|---|---|---|---|
Molecule | Chains | Sequence Length | Organism | Sequence |
Protein Hnrnpl | A | 118 | Pandinus Imperator , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) | QKISRPGDSDDSRSVNSVLLFTILNPIYSITTDVLYTICNPCGPVQRIVIFRKNGVQAMVEFDSVQSAQRAKASLNGADIYSGCCTLKIEYAKPTRLNVFKNDQDTWDYTNPNLSGQG |
Nucleic Acids / Hybrid | ||||
---|---|---|---|---|
Molecule | Chains | Sequence Length | Organism | Sequence |
RNA (5'-R(*AP*CP*AP*CP*AP*C)-3') | b | 6 | NA | ACACAC |
Method: SOLUTION NMR
Deposited Date: 2014-06-24 Deposition Author(s): Allain, F. , Blatter, M.