Nmr structure of spider toxin-trtx-hhn2b
PDB DOI: 10.2210/pdb2mqf/pdb
Classification: TOXIN Organism(s): Haplopelma Hainanum
Deposited: 2014-06-19 Deposition Author(s): Chin, Y.K.Y. , Klint, J.K. , Mobli, M.
Method: SOLUTION NMR Resolution: N.A.
Nmr structure of spider toxin-trtx-hhn2b
Chin, Y.K.Y. , Klint, J.K. , Mobli, M.
Primary Citation of Related Structures: 2MQF
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Mu-theraphotoxin-Hhn2b | A | 34 | Haplopelma Hainanum | AECKGFGKSCVPGKNECCSGYACNSRDKWCKVLL |
Method: SOLUTION NMR
Deposited Date: 2014-06-19 Deposition Author(s): Chin, Y.K.Y. , Klint, J.K. , Mobli, M.