Ww3 domain of nedd4l in complex with its hect domain py motif
PDB DOI: 10.2210/pdb2mpt/pdb
Classification: LIGASE Organism(s): Homo Sapiens , Synthetic Construct
Deposited: 2014-06-02 Deposition Author(s): Aragon, E. , Escobedo, A. , Gomes, T. , Macias, M.J. , Martin-Malpartida, P. , Ruiz, L.
Method: SOLUTION NMR Resolution: N.A.
Ww3 domain of nedd4l in complex with its hect domain py motif
Aragon, E. , Escobedo, A. , Gomes, T. , Macias, M.J. , Martin-Malpartida, P. , Ruiz, L.
Primary Citation of Related Structures: 2MPT
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| E3 ubiquitin-protein ligase NEDD4-like | A | 48 | Homo Sapiens , Synthetic Construct | GAMEQSFLPPGWEMRIAPNGRPFFIDHNTKTTTWEDPRLKFPVHMRSK |
| E3 ubiquitin-protein ligase NEDD4-like | B | 14 | Homo Sapiens , Synthetic Construct | RLDLPPYETFEDLX |
Method: SOLUTION NMR
Deposited Date: 2014-06-02 Deposition Author(s): Aragon, E. , Escobedo, A. , Gomes, T. , Macias, M.J. , Martin-Malpartida, P. , Ruiz, L.