Ww3 domain of nedd4l in complex with its hect domain py motif
PDB DOI: 10.2210/pdb2mpt/pdb
Classification: LIGASE Organism(s): Salmonella Enterica , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.)
Deposited: 2014-06-02 Deposition Author(s): Aragon, E. , Escobedo, A. , Gomes, T. , Macias, M.J. , Martin-Malpartida, P. , Ruiz, L.
Ww3 domain of nedd4l in complex with its hect domain py motif
Aragon, E. , Escobedo, A. , Gomes, T. , Macias, M.J. , Martin-Malpartida, P. , Ruiz, L.
Primary Citation of Related Structures: 2MPT
Proteins | ||||
---|---|---|---|---|
Molecule | Chains | Sequence Length | Organism | Sequence |
E3 ubiquitin-protein ligase NEDD4-like | A | 48 | Salmonella Enterica , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) | GAMEQSFLPPGWEMRIAPNGRPFFIDHNTKTTTWEDPRLKFPVHMRSK |
E3 ubiquitin-protein ligase NEDD4-like | B | 14 | Salmonella Enterica , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) | RLDLPPYETFEDLX |
Method: SOLUTION NMR
Deposited Date: 2014-06-02 Deposition Author(s): Aragon, E. , Escobedo, A. , Gomes, T. , Macias, M.J. , Martin-Malpartida, P. , Ruiz, L.