Solution structure of mbd4 methyl-cytosine binding domain bound to methylated dna
PDB DOI: 10.2210/pdb2moe/pdb
Classification: Hydrolase/DNA Organism(s): Homo Sapiens , Synthetic Construct
Deposited: 2014-04-24 Deposition Author(s): Walavalkar, N.M. , Williams, D.C.
Solution structure of mbd4 methyl-cytosine binding domain bound to methylated dna
Walavalkar, N.M. , Williams, D.C.
Primary Citation of Related Structures: 2MOE
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Methyl-CpG-binding domain protein 4 | A | 71 | Homo Sapiens , Synthetic Construct | GSTECRKSVPCGWERVVKQRLFGKTAGRFDVYFISPQGLKFRSKSSLANYLHKNGETSLKPEDFDFTVLSK |
Method: SOLUTION NMR
Deposited Date: 2014-04-24 Deposition Author(s): Walavalkar, N.M. , Williams, D.C.