Mengovirus leader: structural characterization of the mengovirus leader protein bound to ran gtpase by nuclear magnetic resonance
PDB DOI: 10.2210/pdb2mmi/pdb
Classification: VIRAL PROTEIN Organism(s): Caldicellulosiruptor Bescii (Strain Atcc Baa-1888 / Dsm 6725 / Z-1320)
Deposited: 2014-03-15 Deposition Author(s): Bacot-Davis, V.R. , Cornilescu, C.C. , Markley, J.L. , Palmenberg, A.C.
Mengovirus leader: structural characterization of the mengovirus leader protein bound to ran gtpase by nuclear magnetic resonance
Bacot-Davis, V.R. , Cornilescu, C.C. , Markley, J.L. , Palmenberg, A.C.
Primary Citation of Related Structures: 2MMI
Proteins | ||||
---|---|---|---|---|
Molecule | Chains | Sequence Length | Organism | Sequence |
Leader protein | A | 71 | Caldicellulosiruptor Bescii (Strain Atcc Baa-1888 / Dsm 6725 / Z-1320) | GSTAMATTMEQEICAHSMTFEECPKCSALQYRNGFYLLKYDEEWYPEELLTDGEDDVFDPDLDMEVVFETQ |
Method: SOLUTION NMR
Deposited Date: 2014-03-15 Deposition Author(s): Bacot-Davis, V.R. , Cornilescu, C.C. , Markley, J.L. , Palmenberg, A.C.