Structure of a conserved golgi complex-targeting signal in coronavirus envelope proteins
PDB DOI: 10.2210/pdb2mm4/pdb
Classification: VIRAL PROTEIN Organism(s): Sars Coronavirus
Deposited: 2014-03-09 Deposition Author(s): Claudine, S. , Li, Y. , Surya, W. , Torres, J.
Structure of a conserved golgi complex-targeting signal in coronavirus envelope proteins
Claudine, S. , Li, Y. , Surya, W. , Torres, J.
Primary Citation of Related Structures: 2MM4
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Envelope small membrane protein | A | 58 | Sars Coronavirus | ETGTLIVNSVLLFLAFVVFLLVTLAILTALRLAAYAANIVNVSLVKPTVYVYSRVKNL |
Method: SOLUTION NMR
Deposited Date: 2014-03-09 Deposition Author(s): Claudine, S. , Li, Y. , Surya, W. , Torres, J.