Solution structure of yscucn in a micellar complex with sds
PDB DOI: 10.2210/pdb2ml9/pdb
Classification: MEMBRANE PROTEIN Organism(s): Yersinia Pseudotuberculosis Ip 32953
Deposited: 2014-02-20 Deposition Author(s): Weise, C.F. , Wolf-Watz, M.
Method: SOLUTION NMR Resolution: N.A.
Solution structure of yscucn in a micellar complex with sds
Primary Citation of Related Structures: 2ML9
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Yop proteins translocation protein U | A | 58 | Yersinia Pseudotuberculosis Ip 32953 | GPLGSIKELKMSKDEIKREYKEMEGSPEIKSKRRQFHQEIQSRNMRENVKRSSVVVAN |
Method: SOLUTION NMR
Deposited Date: 2014-02-20 Deposition Author(s): Weise, C.F. , Wolf-Watz, M.