Ginsentides: characterization, structure and application of a new class of highly stable cystine knot peptides in ginseng
PDB DOI: 10.2210/pdb2ml7/pdb
Classification: UNKNOWN FUNCTION Organism(s): Panax Ginseng
Deposited: 2014-02-20 Deposition Author(s): Luo, S. , Nguyen, K. , Tam, J. , Wang, S. , Yang, D.
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Specific abundant protein 3 | A | 31 | Panax Ginseng | CKSGGAWCGFDPHGCCGNCGCLVGFCYGTGC |
Method: SOLUTION NMR
Deposited Date: 2014-02-20 Deposition Author(s): Luo, S. , Nguyen, K. , Tam, J. , Wang, S. , Yang, D.