Structure of the na,k-atpase regulatory protein fxyd2b in micelles
PDB DOI: 10.2210/pdb2mkv/pdb
Classification: TRANSPORT PROTEIN Organism(s): Homo Sapiens
Deposited: 2014-02-13 Deposition Author(s): Gong, X. , Marassi, F.M.
Method: SOLUTION NMR Resolution: N.A.
Structure of the na,k-atpase regulatory protein fxyd2b in micelles
Primary Citation of Related Structures: 2MKV
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Sodium/potassium-transporting ATPase subunit gamma | A | 64 | Homo Sapiens | LDRWYLGGSPKGDVDPFYYDYETVRNGGLIFAGLAFIVGLLILLSRRFRSGGNKKRRQINEDEP |
Method: SOLUTION NMR
Deposited Date: 2014-02-13 Deposition Author(s): Gong, X. , Marassi, F.M.