Nmr structure of p75 transmembrane domain c257a mutant in dpc micelles
PDB DOI: 10.2210/pdb2mjo/pdb
Classification: MEMBRANE PROTEIN Organism(s): Rattus Norvegicus
Deposited: 2014-01-15 Deposition Author(s): Arseniev, A. , Goncharuk, S. , Mineev, K. , Nadezhdin, K.
Nmr structure of p75 transmembrane domain c257a mutant in dpc micelles
Arseniev, A. , Goncharuk, S. , Mineev, K. , Nadezhdin, K.
Primary Citation of Related Structures: 2MJO
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Tumor necrosis factor receptor superfamily member 16 | A | 41 | Rattus Norvegicus | MTRGTTDNLIPVYASILAAVVVGLVAYIAFKRWNSSKQNKQ |
| Tumor necrosis factor receptor superfamily member 16 | B | 41 | Rattus Norvegicus | MTRGTTDNLIPVYASILAAVVVGLVAYIAFKRWNSSKQNKQ |
Method: SOLUTION NMR
Deposited Date: 2014-01-15 Deposition Author(s): Arseniev, A. , Goncharuk, S. , Mineev, K. , Nadezhdin, K.