Solution nmr structure of phd type 1 zinc finger domain 1 of lysine-specific demethylase lid from drosophila melanogaster, northeast structural genomics consortium (nesg) target fr824j
PDB DOI: 10.2210/pdb2miq/pdb
Classification: OXIDOREDUCTASE Organism(s): Drosophila Melanogaster
Deposited: 2013-12-17 Deposition Author(s): Chaperone-Enabled Studies Of Epigenetic Regulation Enzymes (Cebs) , Eletsky, A. , Everett, J.K. , Janjua, H. , Maglaqui, M. , Montelione, G.T. , Northeast Structural Genomics Consortium (Nesg) , Shastry, R. , Sukumaran, D.K. , Szyperski, T. , Xiao, R. , Xu, X.
Method: SOLUTION NMR Resolution: N.A.
Solution nmr structure of phd type 1 zinc finger domain 1 of lysine-specific demethylase lid from drosophila melanogaster, northeast structural genomics consortium (nesg) target fr824j
Chaperone-Enabled Studies Of Epigenetic Regulation Enzymes (Cebs) , Eletsky, A. , Everett, J.K. , Janjua, H. , Maglaqui, M. , Montelione, G.T. , Northeast Structural Genomics Consortium (Nesg) , Shastry, R. , Sukumaran, D.K. , Szyperski, T. , Xiao, R. , Xu, X.
Primary Citation of Related Structures: 2MIQ
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Lysine-specific demethylase lid | A | 94 | Drosophila Melanogaster | SHMSGGSPLATGTTANTRGASQKKGGEPPALIVDPLMKYICHICNRGDVEESMLLCDGCDDSYHTFCLLPPLTSIPKGEWLCPRCVVEEVSKPQ |
Method: SOLUTION NMR
Deposited Date: 2013-12-17 Deposition Author(s): Chaperone-Enabled Studies Of Epigenetic Regulation Enzymes (Cebs) , Eletsky, A. , Everett, J.K. , Janjua, H. , Maglaqui, M. , Montelione, G.T. , Northeast Structural Genomics Consortium (Nesg) , Shastry, R. , Sukumaran, D.K. , Szyperski, T. , Xiao, R. , Xu, X.